Dataset for protein Bax of organism Bos taurus

[Download (right click)] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A3Q1MN40_BAX-02      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQV
A0A3Q1MN40_BAX-01      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQV
A0A3Q1MN40_BAX-03      -------------------MKTGALLLQGFIQDRAGRMGGETPELGLEQV
                                          *******************************

A0A3Q1MN40_BAX-02      PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMF
A0A3Q1MN40_BAX-01      PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMF
A0A3Q1MN40_BAX-03      PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMF
                       **************************************************

A0A3Q1MN40_BAX-02      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
A0A3Q1MN40_BAX-01      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
A0A3Q1MN40_BAX-03      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
                       **************************************************

A0A3Q1MN40_BAX-02      WIQDQGGWVRPLTPPHSPTPLGPLGLSVPTIGVPPSPFWGHMSDQPLIHR
A0A3Q1MN40_BAX-01      WIQDQGGWDGLLSYFGTPTWQT-VTIFVAGVLT-----------------
A0A3Q1MN40_BAX-03      WIQDQGGWVRPLTPPHSPTPLGPLGLSVPTIGVPPSPFWGHMSDQPLIHR
                       ********   *:   :**    : : *. : .                 

A0A3Q1MN40_BAX-02      VPNDLSMTLDLLVTSDLLVTPDPMPRCPPWCLPPIPLESLKFYDNPLTSP
A0A3Q1MN40_BAX-01      --------------------------------------------------
A0A3Q1MN40_BAX-03      VPNDLSMTLDLLVTSDLLVTPDPMPRCPPWCLPPIPLESLKFYDNPLTSP
                                                                         

A0A3Q1MN40_BAX-02      LVGPCPYLCPLTPPCSLMCWPRGCPLAESLKCLLSLSPGRPPLLLWDTHM
A0A3Q1MN40_BAX-01      --------------ASLTIW------------------------------
A0A3Q1MN40_BAX-03      LVGPCPYLCPLTPPCSLMCWPRGCPLAESLKCLLSLSPGRPPLLLWDTHM
                                     .**  *                              

A0A3Q1MN40_BAX-02      ADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQGGGADLGAME
A0A3Q1MN40_BAX-01      --------------------------------------------------
A0A3Q1MN40_BAX-03      ADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQGGGADLGAME
                                                                         

A0A3Q1MN40_BAX-02      FFLLF
A0A3Q1MN40_BAX-01      -KKMG
A0A3Q1MN40_BAX-03      FFLLF
                          : 

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice