Dataset for protein Bax of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O02703_BAX-02      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLS
O02703_BAX-01      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLS
                   ************************************************************

O02703_BAX-02      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
O02703_BAX-01      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
                   ************************************************************

O02703_BAX-02      VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPLTPPHSPTPLGPLGLSVPT
O02703_BAX-01      VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLS-----------------
                   **************************************   *:                 

O02703_BAX-02      IGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVTPDPMPRCPPWCLPPIPLESL
O02703_BAX-01      -------YFG------------------------------------TPTWQTVTIFVAGV
                          ::*                                     *.*   .* : .:

O02703_BAX-02      KFYDNPLTSPLVGPCPYLCPLTPPCSLMCWPRGCPLAESLKCLLSLSPGRPPLLLWDTHM
O02703_BAX-01      ----------------------LTASLTIWKK----------------------------
                                          ..**  * .                            

O02703_BAX-02      ADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQGGGADLGAMEFFLLF
O02703_BAX-01      ---------------------------------------------MG--------
                                                                :*        

© 1998-2020Legal notice