Dataset for protein Bax of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1J1X1_BAX-01      MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTENP
A0A3B1J1X1_BAX-02      MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTENP
A0A3B1JGN3_BAX-01      -----------------MAAQGEGYAVNLLRIGYRLLINFISERLQRTLE
W5KCK0_BAX-01          -------------MFVCSVFKGNGNE-QLLDLGASLLKDFIYQRVQRHGD
                                         .   :    :::  *  :* .::  *:.    

A0A3B1J1X1_BAX-01      DVRVSRVDLGGRPDEGDDPQIKVVVEQLLRIADDLNRNTELQHLISTVQA
A0A3B1J1X1_BAX-02      DVRVSRVDLGGRPDEGDDPQIKVVVEQLLRIADDLNRNTELQHLISTVQA
A0A3B1JGN3_BAX-01      IDAAVTKNLLDETEEVPDPNIKKVGQRLQQFGDELDNDTKLKEMINN--L
W5KCK0_BAX-01          SNALVTRNQLGGT-ELCDPSHKRLAQCLQQIGDELDSNVQLQSMINDSAL
                              :  . . *  **. * : : * .:.*:*: :.:*: :*.    

A0A3B1J1X1_BAX-01      NCAQDVFMTVARTIFTDG-INWGRIVALFHLAYQLIYNALTQNHLEIIKN
A0A3B1J1X1_BAX-02      NCAQDVFMTVARTIFTDG-INWGRIVALFHLAYQLIYNTLREETIMSNQQ
A0A3B1JGN3_BAX-01      MPTKEVFLKIAYEIFSDWKFNWGRVVALFYFACEFV-----KMVPDIISN
W5KCK0_BAX-01          QPTQDVFVKVACEIFSDGKFNWGRVVALFYFACRLVIKAVLTKLPDIIRT
                         :::**:.:*  **:*  :****:****::*  ::              

A0A3B1J1X1_BAX-01      IISWV-LQYIRQHVSAWIRQQGGWEGVIRSV--SRWRTVTVIAAVAFIAA
A0A3B1J1X1_BAX-02      TLSNLPRELVRTAVVEIVSTTRFLFWFQTSL--TPW-------GKCFLCL
A0A3B1JGN3_BAX-01      IISWT-LEFMRDHVIAWISGQGGWDAILSQIEAPSWTTVTAFVAGVLTTA
W5KCK0_BAX-01          IINWT-VDYLREHVINWIREQGGWEGIRSYFGTPTWQTVGVFLAGVLTTV
                        :..   : :*  *   :        .   .  . *       .  :   

A0A3B1J1X1_BAX-01      AVYWKRSR
A0A3B1J1X1_BAX-02      LLFFSEAK
A0A3B1JGN3_BAX-01      LIVNKM--
W5KCK0_BAX-01          LVMRKM--
                        :  .   

© 1998-2020Legal notice