Dataset for protein BAX-like of organism Anser cygnoides

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8B9EM33_BAK1-01      MGNDGDPPGAHGRRGSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQQE
A0A8B9IHS5_BOK-01       M---------------------EVLRRSSVFAAEVMEV------------
                        *                     : *. .. .* *. **            

A0A8B9EM33_BAK1-01      REESGEEVPLDPEIAEIQQEL--------------------------GST
A0A8B9IHS5_BOK-01       ----FDRSPTDKELVSQAKALCRDYINSRLVRAGVSWSKPDGNAPVPGGK
                             :. * * *:..  : *                          *..

A0A8B9EM33_BAK1-01      GSLVGRRLAIIGDDINKRYDAEFRYMLKSLQPT---KENAYEYFTTIASS
A0A8B9IHS5_BOK-01       LAEVSTILLRLGDELEYIRPNVYRNIARQLNISLHSETVVTDAFLAVAAQ
                         : *.  *  :**:::      :* : :.*: :   :  . : * ::*:.

A0A8B9EM33_BAK1-01      LFESGINWGRVIALLGFGYCMAIHVYQHGITGFLRRIARFVTEFMLRNRI
A0A8B9IHS5_BOK-01       IFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFV-RKTL
                        :* :**.**:*::* ...  :*:.  :*. ..::: *.  : **: *: :

A0A8B9EM33_BAK1-01      AQWIAQQGGWVTWGRVAALDLDNVYMKYMLAVVALVMVGHLVVRRFFR--
A0A8B9IHS5_BOK-01       VTWLKRRGGWADITKCV-VNTDPSL-RSHWLVAAVCSFGHFLKAIFFVLL
                        . *: ::***.   : . :: *    :    *.*:  .**::   **   

A0A8B9EM33_BAK1-01      --P
A0A8B9IHS5_BOK-01       PER
                           

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice