Dataset for protein BAX-like of organism Anser brachyrhynchus

[Download (right click)] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8B9C1S2_BAK1-01      MASGNDGDPPGAHGRRGSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQ
A0A8B9CMI6_BOK-01       M-----------------------EVLRRSSVFAAEVMEVF---------
A0A8B9C1S2_BAK1-02      MASGNDGDPPGAHGRRGSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQ
                        *                       : *. .. .* *. ***         

A0A8B9C1S2_BAK1-01      QEREESGEEVPLDPEIAEIQQEL--------------------------G
A0A8B9CMI6_BOK-01       -------DRSPTDKELVSQAKALCRDYINSRLVRAGVSWSKPDGNAPVPG
A0A8B9C1S2_BAK1-02      QEREESGEEVPLDPEIAEIQQEL--------------------------G
                               :. * * *:..  : *                          *

A0A8B9C1S2_BAK1-01      STGSLVGRRLAIIGDDINKRYDAEFRYMLKSLQPT---KENAYEYFTTIA
A0A8B9CMI6_BOK-01       GKLAEVSTILLRLGDELEYIRPNVYRNIARQLNISLHSETVVTDAFLAVA
A0A8B9C1S2_BAK1-02      STGSLVGRRLAIIGDDINKRYDAEFRYMLKSLQPT---KENAYEYFTTIA
                        .. : *.  *  :**:::      :* : :.*: :   :  . : * ::*

A0A8B9C1S2_BAK1-01      SSLFESGINWGRVIALLGFGYCMAIHVYQHGITGFLRRIARFVTEFMLRN
A0A8B9CMI6_BOK-01       AQIFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFV-RK
A0A8B9C1S2_BAK1-02      SSLFESGINWGRVIALLGFGYCMAIHVYQHGITGFLRRIARFVTEFMLRN
                        :.:* :**.**:*::* ...  :*:.  :*. ..::: *.  : **: *:

A0A8B9C1S2_BAK1-01      RIAQWIAQQGGWVAA----LDLDNVYMKYMLAVVALVMVGHLVVRRFFR-
A0A8B9CMI6_BOK-01       TLVTWLKRRGGWADITKCVVNTDP-SLRSHWLVAAVCSFGHFLKAIFFVL
A0A8B9C1S2_BAK1-02      RIAQWIAQQGGWVAA----LDLDNVYMKYMLAVVALVMVGHLVVRRFFR-
                         :. *: ::***.      :: *   ::    *.*:  .**::   **  

A0A8B9C1S2_BAK1-01      ---P
A0A8B9CMI6_BOK-01       LPER
A0A8B9C1S2_BAK1-02      ---P
                            

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice