Dataset for protein Bax of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


R9Y0N7_BAX-01          -----------MASYPGG--GDQGNTKDQILEVGCVLLKDFIYERIQRHG
A0A3Q1I5B7_BAX-02      MADSREEEKKDGDEEPQGAVGGEGM---------------FVIERLSTD-
A0A3Q1I5B7_BAX-01      MADSREEEKKDGDEEPQGAVGGEDVVDDSIMEQAAVVLRGFVIERLSTD-
                                    . * *  *.:.                *: **:.   

R9Y0N7_BAX-01          DASTAVTRAQLGG--GELCDPNHKKLAQCLQQIGDELDANVDLQRMINDS
A0A3Q1I5B7_BAX-02      DPGQQVSPEQLGGRPNEQQDPQIKDVVDQLIKIAEELNRNAELQQLINQV
A0A3Q1I5B7_BAX-01      DPGQQVSPEQLGGRPNEQQDPQIKDVVDQLIKIAEELNRNAELQQLINQV
                       *..  *:  ****  .*  **: *.:.: * :*.:**: *.:**.:**: 

R9Y0N7_BAX-01          SLSPTKDIFMKVALEIFSDGKFNWGRVVALFYFACRLVIKAVVTQVPDII
A0A3Q1I5B7_BAX-02      QSNCAHDVFMTVVRSIFADG-INWGRVVALFHLAYRLIHRALTTNHLDNI
A0A3Q1I5B7_BAX-01      QSNCAHDVFMTVVRSIFADG-INWGRVVALFHLAYRLIHRALTTNHLDNI
                       . . ::*:**.*. .**:** :*********::* **: .*:.*:  * *

R9Y0N7_BAX-01          RTIISWTMDYLREHVINWIREQGGWEGIRSYFGTPTWQTVGVFLAGVLTT
A0A3Q1I5B7_BAX-02      RMVFNWFLEVIRELLYSWLVQQGGWVGVIR--GFSRWRTVAIAASVILVA
A0A3Q1I5B7_BAX-01      RMVFNWFLEVIRELLYSWLVQQGGWVGVIR--GFSRWRTVAIAASVILVA
                       * ::.* :: :** : .*: :**** *:    * . *.**.:  : :*.:

R9Y0N7_BAX-01          VLVIRKM--
A0A3Q1I5B7_BAX-02      TFVYYRKTR
A0A3Q1I5B7_BAX-01      TFVYYRKTR
                       .:*  .   

© 1998-2020Legal notice