Dataset for protein classical BH3-containing proteins of organism Urocitellus parryii

[Download (right click)] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8D2GV39_BIK-01          MSEARP-----------VSRS-----------------------------
A0A8D2HBG2_HRK-01          MCPC-P--------------------------------------------
A0A8D2KFP4_BAD-02          MFQIPEFEPSEQEDSSSAEGG-----------------------------
A0A8D2HTN1_BMF-01          MPRAGVFWKQYR----AVRGGLLR---RP---------------------
A0A8D2HTN1_BMF-02          MR------------------------------------------------
A0A8D2KQ57_BCL2L11-02      MAKQPSDVSSEC----DREGGQLQPAERP---------------------
A0A8D2HID1_BBC3-01         MARARQEGSSPE----PVEGL-ARDGPRPFPLGRLVPSAVSCGLCEPGLP
A0A8D2HL26_PMAIP1-01       MPGKKGWKN------------------------------------EQLPP
A0A8D2HTN1_BMF-03          --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      MAKQPSDVSSEC----DREGGQLQPAERP---------------------
A0A8D2KFP4_BAD-01          MFQIPEFEPSEQEDSSSAEGG-----------------------------
                                                                             

A0A8D2GV39_BIK-01          --------------------------------------------------
A0A8D2HBG2_HRK-01          --------------------------------------------------
A0A8D2KFP4_BAD-02          -----------L----------GP-SPAG-DRPGPYKNQPPGCGLAPGLP
A0A8D2HTN1_BMF-01          -----PESAAAA----------GP-ASGS-RLPPPASRQSPL--LSPSFP
A0A8D2HTN1_BMF-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      -----PQLRPGAPTSLQTEPQGNPEGEGD-RC-PHGSPQGPL--APPASP
A0A8D2HID1_BBC3-01         AAPAAPALLPAAYLCAPTAPPAVTAALGVPRW-P----GGPR--SRPRGP
A0A8D2HL26_PMAIP1-01       ATPATPVEL-----------------------------------------
A0A8D2HTN1_BMF-03          --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      -----PQLRPGAPTSLQTEPQ-----------------------------
A0A8D2KFP4_BAD-01          -----------L----------GP-SPAG-DRPGPYKNQPPGCGLAPGLP
                                                                             

A0A8D2GV39_BIK-01          --------------------------------------------------
A0A8D2HBG2_HRK-01          --------------------------------------------------
A0A8D2KFP4_BAD-02          ---RDTGHQQRQ------ATSSSNHGGAGATE--TRS----RHSSYP---
A0A8D2HTN1_BMF-01          ---IESGRQAPVFITLDPGTEPWHHDSEAETL--SWS----HPEEMEPPQ
A0A8D2HTN1_BMF-02          -----------------CRTHIWAHCSKWKLWGSIWNSKELGAEEMEPPQ
A0A8D2KQ57_BCL2L11-02      ---GPFATRSPLFIFVRRSSLL--SRSSSGYF--SFD----TDRSPA---
A0A8D2HID1_BBC3-01         RPDGPQPSLSP---------------------------------------
A0A8D2HL26_PMAIP1-01       --------------------------------------------------
A0A8D2HTN1_BMF-03          ------------------------------------V----FPEEMEPPQ
A0A8D2KQ57_BCL2L11-01      ------------------------------------------DRSPA---
A0A8D2KFP4_BAD-01          ---RDTGHQQRQ------ATSSSNHGGAGATE--TRS----RHSSYP---
                                                                             

A0A8D2GV39_BIK-01          --------------------------------------LLRYRPGPLLAA
A0A8D2HBG2_HRK-01          --------------------------------------LHRGRGPPAVCA
A0A8D2KFP4_BAD-02          --------------------------------------------------
A0A8D2HTN1_BMF-01          CVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHC
A0A8D2HTN1_BMF-02          CVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHC
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2HID1_BBC3-01         --------------------------------------------------
A0A8D2HL26_PMAIP1-01       --------------------------------------------------
A0A8D2HTN1_BMF-03          CVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHC
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8D2KFP4_BAD-01          --------------------------------------------------
                                                                             

A0A8D2GV39_BIK-01          GASCLTPPAGEEVLRPGGRLHLRVQ-------------------------
A0A8D2HBG2_HRK-01          --------------CSAGRLGLRSS-------------------------
A0A8D2KFP4_BAD-02          ------------------------A-DTDLDEGMEEEP------------
A0A8D2HTN1_BMF-01          --------------CGPG---LRPTSQEDKATQTLSPASPSQGVMLPCGV
A0A8D2HTN1_BMF-02          --------------CGPG---LRPTSQEDKATQTLSPASPSQGVMLPCGV
A0A8D2KQ57_BCL2L11-02      -----------------------PM-SCDKSTQTPSPPCQAFNHYL----
A0A8D2HID1_BBC3-01         ------------------------A-EQHLESPVPSAP------------
A0A8D2HL26_PMAIP1-01       --------------------------------------------------
A0A8D2HTN1_BMF-03          --------------CGPG---LRPTSQEDKATQTLSPASPSQGVMLPCGV
A0A8D2KQ57_BCL2L11-01      -----------------------PM-SCDKSTQTPSPPCQAFNHYL----
A0A8D2KFP4_BAD-01          ------------------------A-DTDLDEGMEEEP------------
                                                                             

A0A8D2GV39_BIK-01          --------------------------------------GSHQVALRLACI
A0A8D2HBG2_HRK-01          --------------------------------------AAQLTAARLKAL
A0A8D2KFP4_BAD-02          ----SPF------------RG-RSRSAP------PNLWAAQRYGRELRRM
A0A8D2HTN1_BMF-01          TEEPQRLFYGNAGYRLPLPAS-FPAGLPLGEQPPEGQWQ-HRAEVQIARK
A0A8D2HTN1_BMF-02          TEEPQRLFYGNAGYRLPLPAS-FPAGLPLGEQPPEGQWQ-HRAEVQIARK
A0A8D2KQ57_BCL2L11-02      ----SAM------------ASMRESQAEPADM-RPEIW----IAQELRRI
A0A8D2HID1_BBC3-01         ----EAL------------AG-GPTQAAPGVRGEEEQWA-REIGAQLRRM
A0A8D2HL26_PMAIP1-01       -----------------------------------------ESGIQLRRF
A0A8D2HTN1_BMF-03          TEEPQRLFYGNAGYRLPLPAS-FPAGLPLGEQPPEGQWQ-HRAEVQIARK
A0A8D2KQ57_BCL2L11-01      ----SAM------------ASMRESQAEPADM-RPEIW----IAQELRRI
A0A8D2KFP4_BAD-01          ----SPF------------RG-RSRSAP------PNLWAAQRYGRELRRM
                                                                        .:   

A0A8D2GV39_BIK-01          GDEMDLCFRGLQLAQLPGMAMHSLALSYSQARVTGVLRSLTQGLASLREN
A0A8D2HBG2_HRK-01          GDELH------------------------------------------QRT
A0A8D2KFP4_BAD-02          SDEFEGSFKGLPRP---------------------------------RSA
A0A8D2HTN1_BMF-01          LQCIADQFH--------------------------------------RLH
A0A8D2HTN1_BMF-02          LQCIADQFH--------------------------------------RLH
A0A8D2KQ57_BCL2L11-02      GDEFNLYYP--------------------------------------RRV
A0A8D2HID1_BBC3-01         ADDLNAQYE--------------------------------------RRR
A0A8D2HL26_PMAIP1-01       GDKVNFRQ------------------------------------------
A0A8D2HTN1_BMF-03          LQCIADQFH--------------------------------------RLH
A0A8D2KQ57_BCL2L11-01      GDEFNLYYP--------------------------------------RRV
A0A8D2KFP4_BAD-01          SDEFEGSFKGLPRP---------------------------------RSA
                            : .                                              

A0A8D2GV39_BIK-01          MWFWRPAVPPARACR---ELLP---VL-LLLG---LL-LSRALYLRLQ
A0A8D2HBG2_HRK-01          MWRRRARSPRAPAPGALPTYWP---WL-CAAAQVAAL-AAWLLGRRNL
A0A8D2KFP4_BAD-02          GTASQMRQSS--------SWTR---FI----QSWWDRNLGRRGSAPSQ
A0A8D2HTN1_BMF-01          MQQHQQNRNR--------VWWQ---IL-LFLHNLALNGDENRDRAGPR
A0A8D2HTN1_BMF-02          MQQHQQNRNR--------VWWQ---IL-LFLHNLALNGDENRDRAGPR
A0A8D2KQ57_BCL2L11-02      FFNNYQPEDR--------PQMVILRLLRCIIRLVWRM----------H
A0A8D2HID1_BBC3-01         QEEQQRHRPS--------PWRV---LYNLIMGLLPLPRGHGAPEMEPN
A0A8D2HL26_PMAIP1-01       ---------------------K---LLNLISKLFSLV----------T
A0A8D2HTN1_BMF-03          MQQHQQNRNR--------VWWQ---IL-LFLHNLALNGDENRDRAGPR
A0A8D2KQ57_BCL2L11-01      FFNNYQPEDR--------PQMVILRLLRCIIRLVWRM----------H
A0A8D2KFP4_BAD-01          GTASQMRQSS--------SWTR---FI----QSWWDRNLGRRGSAPSQ
                                                                           

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice