Dataset for protein Noxa of organism Theropithecus gelada

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8D2E6G0_PMAIP1-02      --------------------------------------------------
A0A8D2E6G0_PMAIP1-01      HPVYLAVPRVRAVDPGTPARGSVRVQLASCRRPTCSSWRPRFPGSVAEWA
                                                                            

A0A8D2E6G0_PMAIP1-02      -----MPGKKARKNVQPSPTRAQAGAGTAGTARDQAGFGIGMQLHFTRGK
A0A8D2E6G0_PMAIP1-01      AAPAEMPGKKARKNVQPSPTRAQAELEV----------------------
                               *******************   .                      

A0A8D2E6G0_PMAIP1-02      KLVSSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTL
A0A8D2E6G0_PMAIP1-01      --------------------------------------------------
                                                                            

A0A8D2E6G0_PMAIP1-02      LLRNLTASKTWIRGLQKRLFLRRCTLHQFEERLHCNW
A0A8D2E6G0_PMAIP1-01      ------ECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
                                 . * :* : .:* :*:  *: : : : .. 

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice