Dataset for protein classical BH3-containing proteins of organism Takifugu rubripes

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674MXC1_BAD-04      ---------MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTL
A0A674MXC1_BAD-01      ---------MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTL
A0A674MXC1_BAD-02      ---------MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTL
A0A674MXC1_BAD-03      ---------MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTL
A0A3B5KWG6_BMF-03      MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHS-GMLPCGVA
A0A3B5KWG6_BMF-02      MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHS-GMLPCGVA
A0A3B5KWG6_BMF-01      MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHS-GMLPCGVA
                                 .  :*  :  :.  .*: .    ..:*: :.  :*   . 

A0A674MXC1_BAD-04      TLPELRLTGTSRTRVSSESQASTFSREEELQGNGEDEAGTPTEGAPFRGR
A0A674MXC1_BAD-01      TLPELRLTGTSRTRVSSESQASTFSREEELQGNGEDEAGTPTEGAPFRGR
A0A674MXC1_BAD-02      TLPELRLTGTSRTRVSSESQASTFSREEELQGNGEDEAGTPTEGAPFRGR
A0A674MXC1_BAD-03      TLPELRLTGTSRTRVSSESQASTFSREEELQGNGEDEAGTPTEGAPFRGR
A0A3B5KWG6_BMF-03      EEPRLLFYGNAGFRLHFPAR---FEVLGDRGVRRRDTGGAPNGMEPL---
A0A3B5KWG6_BMF-02      EEPRLLFYGNAGFRLHFPAR---FEVLGDRGVRRRDTGGAPNGMEPL---
A0A3B5KWG6_BMF-01      EEPRLLFYGNAGFRLHFPAR---FEVLGDRGVRRRDTGGAPNGMEPL---
                         * * : *.:  *:   :.   *.   :   .  * .*:*.   *:   

A0A674MXC1_BAD-04      SRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSR
A0A674MXC1_BAD-01      SRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSR
A0A674MXC1_BAD-02      SRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSR
A0A674MXC1_BAD-03      SRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSR
A0A3B5KWG6_BMF-03      PQQGPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPL-------
A0A3B5KWG6_BMF-02      PQHGPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPL-------
A0A3B5KWG6_BMF-01      PQQGPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPL-------
                       .. .* .  :    *.:*. :.*:*     :   *: .. *.        

A0A674MXC1_BAD-04      SWWSYLFSHQETEGENGHHDGHTHRTE-
A0A674MXC1_BAD-01      SWWSYLFSHQETEGENGHHDGHTHRTE-
A0A674MXC1_BAD-02      SWWSYLFSHQETEGENGHHDGHTHRTE-
A0A674MXC1_BAD-03      SWWSYLFSHQETEGENGHHDGHTHRTE-
A0A3B5KWG6_BMF-03      -WWAPGHRSAQPSV--------------
A0A3B5KWG6_BMF-02      -WWRLGTALLSLLFDRGFVAGGGGAGRR
A0A3B5KWG6_BMF-01      -WWRLGTALLSLLFDRGFVAGGGGAGRR
                        **       .                 

© 1998-2021Legal notice