Dataset for protein Bim of organism Sciurus vulgaris

[Download (right click)] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8D2B0V4_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPQGEGDR
A0A8D2B0V4_BCL2L11-02      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8D2D0L1_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTD-----------
                           **************************************:           

A0A8D2B0V4_BCL2L11-01      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8D2B0V4_BCL2L11-02      -----------------------------------------------DRS
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
                                                                             

A0A8D2B0V4_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADTRPEIWIAQEL
A0A8D2B0V4_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADTRPEIWIAQEL
A0A8D2D0L1_BCL2L11-01      -------------------------AMASMRQSQAEPADTRPEIWIAQEL
                                                    *************************

A0A8D2B0V4_BCL2L11-01      RRIGDEFNAYYPRRVFFNNYQAEDHPQMVILRLLRYIIRLVWRMH
A0A8D2B0V4_BCL2L11-02      RRIGDEFNAYYPRRVFFNNYQAEDHPQMVILRLLRYIIRLVWRMH
A0A8D2D0L1_BCL2L11-01      RRIGDEFNAYYPRRVFFNNYQAEDHPQMVILRLLRYIIRLVWRMH
                           *********************************************

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice