Dataset for protein Bim of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N4NUH6_BCL2L11      MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNSGEGD
A0A7N4NUH6_BCL2L11      MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNSGEGD
A0A7N4NUH6_BCL2L11      MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQ-------
A0A7N4NUH6_BCL2L11      MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQ-------
                        *******************************************       

A0A7N4NUH6_BCL2L11      SCSPSSPQGPFAPPTSPSPFATRSPLFIFVRRSPLLPRSSSGYFSFDTDR
A0A7N4NUH6_BCL2L11      SCSPSSPQGPFAPPTSPSPFATRSPLFIFVRRSPLLPRSSSGYFSFDTDR
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      ------------------------------------------------DR
                                                                          

A0A7N4NUH6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQSIPADMRPEI
A0A7N4NUH6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASMRQSQSIPADMRPEI
A0A7N4NUH6_BCL2L11      ---------------------------------ASMRQSQSIPADMRPEI
A0A7N4NUH6_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASMRQSQSIPADMRPEI
                                                         *****************

A0A7N4NUH6_BCL2L11      WIAQELRRIGDEFNASYPRRAVWHG---------------FKSFGIGVGS
A0A7N4NUH6_BCL2L11      WIAQELRRIGDEFNASYPRRGFLDNNYQAADDHHQMVILRLLHYIIRLVW
A0A7N4NUH6_BCL2L11      WIAQELRRIGDEFNASYPRRNVIVT------------MWKFTERVLSIDK
A0A7N4NUH6_BCL2L11      WIAQELRRIGDEFNASYPRRNVIVT------------MWKFTERVLSIDK
                        ******************** .                  :    : :  

A0A7N4NUH6_BCL2L11      QL---
A0A7N4NUH6_BCL2L11      RMQ--
A0A7N4NUH6_BCL2L11      YIKVL
A0A7N4NUH6_BCL2L11      YIKVL
                         :   

© 1998-2021Legal notice