Dataset for protein Puma of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6STD6_BBC3-02      MKCGMGSAWACPCQVPRASSLTWVPCQMCGSQPSLSLAEQHLESPVPSAP
A0A2K6STD6_BBC3-01      MKCGMGSAWACPCQVPRASSLTWVPCQMCETRRAAATPPLTLEGPVQSHH
                        ***************************** :. : : .   **.** *  

A0A2K6STD6_BBC3-02      G--ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
A0A2K6STD6_BBC3-01      GTPALSQGPQSPRDGA---------QLGACTRPV--------DVRDSGGR
                        *  **: ** ..  *.         ::**  * :        : * .  .

A0A2K6STD6_BBC3-02      PQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
A0A2K6STD6_BBC3-01      PLPPPDTLASAGDFLCTM---------------
                        *   *..     :::  :               

© 1998-2020Legal notice