Dataset for protein Bad of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TG62_BAD-03      MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASH
A0A2K6TG62_BAD-01      MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASH
                       **************************************************

A0A2K6TG62_BAD-03      QQGQPTSSSHHGENPSAKMLSKASAGMSAPATDSEAQHTENVKLEALEPW
A0A2K6TG62_BAD-01      QQGQPTSSSHHGGAGAVETRSRHSSYPAGTEGDEGME-------EEPSPF
                       ************   :.:  *. *:  :..  *.  :       *  .*:

A0A2K6TG62_BAD-03      RHGVATARTPQ----GRRGTKGWRRSPALFGAVRA-RHPPTSGQHSDMAA
A0A2K6TG62_BAD-01      R-GRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQ
                       * * : : .*:     * * : .* *  :..:...  .* ::*  ::*  

A0A2K6TG62_BAD-03      SS----------------GG-----
A0A2K6TG62_BAD-01      SSSWTRVIQSWWDRNLGRGGSAPSQ
                       **                **     

© 1998-2020Legal notice