Dataset for protein Bim of organism Rhinolophus ferrumequinum

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671FCV3_BCL2L11      MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSVQIERQ---------
A0A671FCV3_BCL2L11      MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSVQIERQGNPEGEGDR
A0A671FCV3_BCL2L11      MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSVQIERQGNPEGEGDR
A0A671FCV3_BCL2L11      MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSVQIERQGNPEGEGDR
                        *****************************************         

A0A671FCV3_BCL2L11      -----------------------------------------------DRS
A0A671FCV3_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A671FCV3_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A671FCV3_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                       ***

A0A671FCV3_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQPQALPADLRPEIWIAQEL
A0A671FCV3_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQPQALPADLRPEIWIAQEL
A0A671FCV3_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAM-------GLPE------------
A0A671FCV3_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQPQALPADLRPEIWIAQEL
                        ***************************       .**             

A0A671FCV3_BCL2L11      RRIGDEFNACYPRRARFVLGSHTEVPGIEAEKKGARTAVLAGLYPRSRFH
A0A671FCV3_BCL2L11      RRIGDEFNACYPRRVFLNNYRAAGAHPRMAVIRLLRYILRLLWRMQ----
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      RRIGDEFNACYPRRFGQ---------------------------------
                                                                          

A0A671FCV3_BCL2L11      VLRVTLTFFRAA
A0A671FCV3_BCL2L11      ------------
A0A671FCV3_BCL2L11      ------------
A0A671FCV3_BCL2L11      ------------
                                    

© 1998-2020Legal notice