Dataset for protein Puma of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2NZD3_BBC3-02      MKFGMGSAQACPCQVPRASSATWVPCQICGPQPSLSLAEQ------HLESPVPSAPGALA
H2NZD3_BBC3-01      MKFGMGSAQACPCQVPRASSATWVPCQICGPRERHGPRTAGGQLPGARRGPGPRRPAPLP
                    *******************************.   .             .* *  *..*.

H2NZD3_BBC3-02      GGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRH-------------
H2NZD3_BBC3-01      ARP----PGALGSVLRPLRARPGRRPRRPRPAARCLPLRPHRPTRRHRRPGGPPLAGGSP
                    . *    **. *.  .  *   ..  * .         * :   .**             

H2NZD3_BBC3-02      ----RPSPWRVLYNLIMGLL----------------------------------------
H2NZD3_BBC3-01      QPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAA
                        **:* *     : *                                          

H2NZD3_BBC3-02      ----------------------------PLPRGHRAPEMEPN------------------
H2NZD3_BBC3-01      ADGGRPQRAVRAAETRGAAAAPPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVD
                                                *:   * :* :  .                  

H2NZD3_BBC3-02      -------------------------
H2NZD3_BBC3-01      VRDSGGRPLPPPDTLASAGDFLCTM
                                             

© 1998-2022Legal notice