Dataset for protein Puma of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8I5YR99_BBC3-02      MKFGMGSAQACPCQVPRASSATWVPCQICGPQPSLSLAEQ------HLES
A0A8I5YR99_BBC3-01      MKFGMGSAQACPCQVPRASSATWVPCQICGPRERHGPRTAGGQLPGARRG
                        *******************************.   .             .

A0A8I5YR99_BBC3-02      PVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRR
A0A8I5YR99_BBC3-01      PGPRRPAPLPARP----PGALGSVLRPLRARPGRRPRRPRPAARCLPLRP
                        * *  *..*.. *    **. *.  .  *   ..  * .         * 

A0A8I5YR99_BBC3-02      QEEQQRH-----------------RPSPWRVLYNLIMGLL----------
A0A8I5YR99_BBC3-01      HRPTRRHRRPGGPPLAGGSPQPAPRPAPGRSSALALAGGAAPGVARAQRP
                        :   .**                 **:* *     : *            

A0A8I5YR99_BBC3-02      --------------------------------------------------
A0A8I5YR99_BBC3-01      GGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAVRAAETRGAAA
                                                                          

A0A8I5YR99_BBC3-02      --------PLPRGHRAPEMEPN----------------------------
A0A8I5YR99_BBC3-01      APPLALEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLP
                                *:   * :* :  .                            

A0A8I5YR99_BBC3-02      ---------------
A0A8I5YR99_BBC3-01      PPDTLASAGDFLCTM
                                       

© 1998-2023Legal notice