Dataset for protein Bad of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2J8TYJ3_BAD-01      MGTPENPSPAPTHAQDVRQRGSQSMFQIPEFEPSEQEDSSSAERGLGPSP
A0A2J8TYJ3_BAD-02      MGTPENPSPAPTHAQDVRQRGSQSMFQIPEFEPSEQEDSSSAERGLGPSP
A0A2J8TYJ3_BAD-03      ------------------------MFQIPEFEPSEQEDSSSAERGLGPSP
                                               **************************

A0A2J8TYJ3_BAD-01      AGDRPSGSSKHHRQAPGLLRDASHQQEQPTSSSHHGG---------RTWY
A0A2J8TYJ3_BAD-02      AGDRPSGSSKHHRQAPGLLRDASHQQEQPTSSSHHGGAGAVEIRSRHSSY
A0A2J8TYJ3_BAD-03      AGDRPSGSSKHHRQAPGLLRDASHQQEQPTSSSHHGGAGAVEIRSRHSSY
                       *************************************         .: *

A0A2J8TYJ3_BAD-01      SPSWESED--SENPSAGMLAEASAGMSAPAADSEAQHAENVKLEALGLWR
A0A2J8TYJ3_BAD-02      PAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2J8TYJ3_BAD-03      PAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
                       ... *.::  .*:**.    . **  .  **:  ..   .:. * :. :.

A0A2J8TYJ3_BAD-01      SGVA---TAPTPRGRRTTKGWGRSPAPFGAVRARRPPISGQHSAMAASSG
A0A2J8TYJ3_BAD-02      KGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------
A0A2J8TYJ3_BAD-03      KGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------
                       .*:.   :* *.   * :..* *   .:   .  * . : .:        

A0A2J8TYJ3_BAD-01      G
A0A2J8TYJ3_BAD-02      -
A0A2J8TYJ3_BAD-03      -
                        

© 1998-2022Legal notice