Dataset for protein Bim of organism Physeter macrocephalus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2Y9T3Y6_BCL2L11      MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQ---------
A0A2Y9T3Y6_BCL2L11      MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQGNPEGEGDR
A0A2Y9T3Y6_BCL2L11      MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQGNPEGEGDR
                        *****************************************         

A0A2Y9T3Y6_BCL2L11      -----------------------------------------------DRS
A0A2Y9T3Y6_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A2Y9T3Y6_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                       ***

A0A2Y9T3Y6_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQEL
A0A2Y9T3Y6_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQEL
A0A2Y9T3Y6_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQEL
                        **************************************************

A0A2Y9T3Y6_BCL2L11      RRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
A0A2Y9T3Y6_BCL2L11      RRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
A0A2Y9T3Y6_BCL2L11      RRIGDEFNAYYPRRLEQ-----------------------------
                        **************:                               

© 1998-2020Legal notice