Dataset for protein Bim of organism Phocoena sinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9CBP3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDR
A0A8C9CBP3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDR
A0A8C9CBP3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDR
A0A8C9CBP3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQ---------
                        *****************************************         

A0A8C9CBP3_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C9CBP3_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C9CBP3_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C9CBP3_BCL2L11      -----------------------------------------------DRS
                                                                       ***

A0A8C9CBP3_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQEL
A0A8C9CBP3_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQEL
A0A8C9CBP3_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMGLSE-------------------
A0A8C9CBP3_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQEL
                        ***************************.                      

A0A8C9CBP3_BCL2L11      RRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
A0A8C9CBP3_BCL2L11      RRIGDEFNAYYPRRLEQ-----------------------------
A0A8C9CBP3_BCL2L11      ----------------------------------------------
A0A8C9CBP3_BCL2L11      RRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
                                                                      

© 1998-2022Legal notice