Dataset for protein Bim of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A096NYC3_BCL2L11      MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
                                                                          

A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKARTKKDQMAKQPS
A0A096NYC3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKARTKKDQMAKQPS
                                                                    ******

A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A096NYC3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
                        ***********************************               

A0A096NYC3_BCL2L11      ---------------------------------------------DRSPA
A0A096NYC3_BCL2L11      ---------------------------------------------DRSPA
A0A096NYC3_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A096NYC3_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A096NYC3_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A096NYC3_BCL2L11      ---------------------------------------------DRSPA
                                                                     *****

A0A096NYC3_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAM----DEATGS-----SLGIAL----
A0A096NYC3_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDS-----SLWFGFIFTG
A0A096NYC3_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
A0A096NYC3_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
A0A096NYC3_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
A0A096NYC3_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
                        *************************    :    .      :   :    

A0A096NYC3_BCL2L11      -------HREVQWPLEWLASS---------------------
A0A096NYC3_BCL2L11      LDLYGHHHSQDTEQLNHKDFS---------------------
A0A096NYC3_BCL2L11      DEFNAYYARRMSLPPD--------------------------
A0A096NYC3_BCL2L11      DEFNAYYARRLEK-----------------------------
A0A096NYC3_BCL2L11      DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A096NYC3_BCL2L11      DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
                                                                  

© 1998-2022Legal notice