Dataset for protein Bim of organism Papio anubis

[Download (right click)] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-01      MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A096NYC3_BCL2L11-02      MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A096NYC3_BCL2L11-04      --------------------------------------------------
                                                                             

A0A096NYC3_BCL2L11-06      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11-03      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11-01      FLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKARTKKDQMAKQPS
A0A096NYC3_BCL2L11-05      --------------------------------------------MAKQPS
A0A096NYC3_BCL2L11-02      FLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKARTKKDQMAKQPS
A0A096NYC3_BCL2L11-04      --------------------------------------------MAKQPS
                                                                       ******

A0A096NYC3_BCL2L11-06      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A096NYC3_BCL2L11-03      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A096NYC3_BCL2L11-01      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A096NYC3_BCL2L11-05      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A096NYC3_BCL2L11-02      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A096NYC3_BCL2L11-04      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
                           ***********************************               

A0A096NYC3_BCL2L11-06      ---------------------------------------------DRSPA
A0A096NYC3_BCL2L11-03      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A096NYC3_BCL2L11-01      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A096NYC3_BCL2L11-05      ---------------------------------------------DRSPA
A0A096NYC3_BCL2L11-02      ---------------------------------------------DRSPA
A0A096NYC3_BCL2L11-04      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
                                                                        *****

A0A096NYC3_BCL2L11-06      PMSCDKSTQTPSPPCQAFNHYLSAMVVI------------------LEDI
A0A096NYC3_BCL2L11-03      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAE-PADMRPEIRIAQELRRI
A0A096NYC3_BCL2L11-01      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAE-PADMRPEIRIAQELRRI
A0A096NYC3_BCL2L11-05      PMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLGIALHREVQWP------
A0A096NYC3_BCL2L11-02      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAE-PADMRPEIRIAQELRRI
A0A096NYC3_BCL2L11-04      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAE-PADMRPEIRIAQELRRI
                           *************************                         

A0A096NYC3_BCL2L11-06      GDSSLWFGFIFTGLDLYGHHHSQDTEQ------------LNHKDFS
A0A096NYC3_BCL2L11-03      GDEFNA--YYARRMS---------------------------LPPD
A0A096NYC3_BCL2L11-01      GDEFNA--YYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVW-RMH
A0A096NYC3_BCL2L11-05      ---------------------------------------LEWLASS
A0A096NYC3_BCL2L11-02      GDEFNA--YYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVW-RMH
A0A096NYC3_BCL2L11-04      GDEFNA--YYARRLE------------------------------K
                                                                         

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice