Dataset for protein Bmf of organism Panthera tigris altaica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9IYS3_BMF-02      MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLF
A0A8C9IYS3_BMF-01      MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSANLFAQSQLDCPLSHLQLF
                       **************************************************

A0A8C9IYS3_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA
A0A8C9IYS3_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
                       ***********************************************. *

A0A8C9IYS3_BMF-02      ----KPPSSVVADSPLPTQP---GFECRREQEWGRSQ-------------
A0A8C9IYS3_BMF-01      GYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQ
                             *:*. *. **  **    :: * * : .*.              

A0A8C9IYS3_BMF-02      ----------------------------------
A0A8C9IYS3_BMF-01      QHQQNRRRVWWQILLFLHNLALNAEENRNGAGPR
                                                         

© 1998-2022Legal notice