Dataset for protein Bim of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3SN61_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I3SN61_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        **************************************************

A0A2I3SN61_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I3SN61_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                        **************************************************

A0A2I3SN61_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQ
A0A2I3SN61_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------
                        ********************************.                 

A0A2I3SN61_BCL2L11      ELRRIGDEFNAYYARRLEK
A0A2I3SN61_BCL2L11      -------------------
                                           

© 1998-2020Legal notice