Dataset for protein Puma of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9BZA9_BBC3-01      MKFGMGSAQACPCQVPRAASVTWVPCQICGPQPSLSLAEQHLESPVPSAP
A0A2R9BZA9_BBC3-02      MKFGMGSAQACPCQVPRAASVTWVPCQICETRGAAAAPPLALEGPVQSHH
                        ***************************** .. : : .   **.** *  

A0A2R9BZA9_BBC3-01      G--ALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
A0A2R9BZA9_BBC3-02      GTPALTQGPQSPRDGA---------QLGACTRPV--------DVRDSGGR
                        *  **: ** ..  *.         ::**  * :        : * .  .

A0A2R9BZA9_BBC3-01      QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2R9BZA9_BBC3-02      PLPPPDTLASAGDFLCTM---------------
                            *..     :::  :               

© 1998-2020Legal notice