Dataset for protein Bim of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1SSY0_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQ---------
G1SSY0_BCL2L11-02      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQGNPEGDRCA
                       *****************************************         

G1SSY0_BCL2L11-01      ---------------------------------------------DRSPA
G1SSY0_BCL2L11-02      HGSPQGPLAPSASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPA
                                                                    *****

G1SSY0_BCL2L11-01      PMSCDKSTQTPSPPCQAFNHYLSAMGKQSLGKTKPAYGCLHSCVCGVHVT
G1SSY0_BCL2L11-02      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADTRPETWIAQE---
                       *************************..   .:::**     : :.     

G1SSY0_BCL2L11-01      CILLFLKGRGFPSAGCFPRCPPRPGLDWARPKPG-------------AWN
G1SSY0_BCL2L11-02      -----LRRIGDEFNAYYPRRVFLNNYPAAEEQPQMVILRLLRYIVRLVWR
                            *.  *    . :**     .   *  :*              .*.

G1SSY0_BCL2L11-01      LALSLPPGWQGPS
G1SSY0_BCL2L11-02      MH-----------
                       :            

© 1998-2020Legal notice