Dataset for protein Bim of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F9C9V3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQ---------
A0A5F9C9V3_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQGNPEGDRCA
                        *****************************************         

A0A5F9C9V3_BCL2L11      ---------------------------------------------DRSPA
A0A5F9C9V3_BCL2L11      HGSPQGPLAPSASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPA
                                                                     *****

A0A5F9C9V3_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMGKQSLGKTKPAYGCLHSCVCGVHVT
A0A5F9C9V3_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADTRPETWIAQE---
                        *************************..   .:::**     : :.     

A0A5F9C9V3_BCL2L11      CILLFLKGRGFPSAGCFPRCPPRPGLDWARPKPG-------------AWN
A0A5F9C9V3_BCL2L11      -----LRRIGDEFNAYYPRRVFLNNYPAAEEQPQMVILRLLRYIVRLVWR
                             *.  *    . :**     .   *  :*              .*.

A0A5F9C9V3_BCL2L11      LALSLPPGWQGPS
A0A5F9C9V3_BCL2L11      MH-----------
                        :            

© 1998-2022Legal notice