Dataset for protein Bmf of organism Oncorhynchus mykiss

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7SCN2_BMF-01      MDDEEEDMSLQRPVSQCWGTPFREIKFHDRESRDREDTQDRSTQTSTGPN
A0A8K9UY13_BMF-02      MDDEEDDV-FVPDSSHCWRTAFREIKYEDRGTQ------------TPCPA
A0A8C7RCY3_BMF-01      MDDEEDDV-FEPD-SHCWRTAFREIKYEDRGTQ------------TPSPV
A0A8K9UY13_BMF-01      MDDEEDDV-FVPDSSHCWRTAFREIKYEDRGTQ------------TPCPA
                       *****:*: :    *:** *.*****: ** :.            :. * 

A0A8C7SCN2_BMF-01      AVVPRSEGHDIMVPQGHSNNNFPCGVEDNHQSRILFH-------------
A0A8K9UY13_BMF-02      LALP--------------NDMLPCGVA--QEPRPLFY-------------
A0A8C7RCY3_BMF-01      LPLP--------------NNMLPCGVA--QEPRLLFY-------------
A0A8K9UY13_BMF-01      LALP--------------NDMLPCGVA--QEPRPLFYVMPSLSWHTTDNA
                         :*              *: :****   ::.* **:             

A0A8C7SCN2_BMF-01      GNAGFRLHFPARFEPMDDRGERRREDEERRRRMEERPEEERVEDSAEARI
A0A8K9UY13_BMF-02      GNAGFRLHFPARFEQVGDQGPQEQHQVERGRMERLQQQPQQPARSMEVCI
A0A8C7RCY3_BMF-01      GNAGFRLHFPAQFERVGDQGPLG----ERGGMERLNRQPQLPARSIEVCI
A0A8K9UY13_BMF-01      GNAGFRLHFPARFEQVGDQGPQEQHQVERGRMERLQQQPQQPARSMEVCI
                       ***********.** :.*.*       **      . : :    * *. *

A0A8C7SCN2_BMF-01      GRKLREIGDQFHQEHVQLFLRHQRDVLPVWIRLTMALYGFLFNREAPAVP
A0A8K9UY13_BMF-02      GQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALLNLLFEQEA----
A0A8C7RCY3_BMF-01      GQKLQLIGDQFHQEHLQVYHRNQRNMRPLWWRLASALLTLLFEQEA----
A0A8K9UY13_BMF-01      GQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALLNLLFEQEA----
                       *.**. *****:***:*:: *:**:: *:* **: **  :**:.**    

A0A8C7SCN2_BMF-01      HLRGQER----
A0A8K9UY13_BMF-02      -IDGRGRAGWR
A0A8C7RCY3_BMF-01      -IAGGGRAGWR
A0A8K9UY13_BMF-01      -IDGRGRAGWR
                        : *  *    

© 1998-2023Legal notice