Dataset for protein Bmf of organism Nannospalax galili

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6R2L6_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-01      MPRAGVFWKQYRALSRGLLPRQLVPAAAAAAPCATRLPPHPRLLVTLDPG
                                                                         

A0A8C6R2L6_BMF-02      ---------------IFPGEMEPPQCVEELEDDVFQPEDGEPGTQSGSLL
A0A8C6R2L6_BMF-01      AEPWHHDSEAETHSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQSGSLL
                                       .*********************************

A0A8C6R2L6_BMF-02      SADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ
A0A8C6R2L6_BMF-01      SADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ
                       **************************************************

A0A8C6R2L6_BMF-02      GVMLPCGVTEEPQRLFYGNAGYRLPLPTSFPAGLPLGEQAPEGQWQHRAE
A0A8C6R2L6_BMF-01      GVMLPCGVTEEPQRLFYGNAGYRLPLPTSFPAGLPLGEQAPEGQWQHRAE
                       **************************************************

A0A8C6R2L6_BMF-02      VQIARKLQCIADQFHRLHMQQYQQNRDRAWWQVFLFLHNLALNREGNRDG
A0A8C6R2L6_BMF-01      VQIARKLQCIADQFHRLHMQQYQQNRDRAWWQVFLFLHNLALNREGNRDG
                       **************************************************

A0A8C6R2L6_BMF-02      AGPR
A0A8C6R2L6_BMF-01      AGPR
                       ****

© 1998-2023Legal notice