Dataset for protein Bmf of organism Mus spicilegus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6GZK8_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-03      --------------------------------------------------
A0A8C6GZK8_BMF-01      MPGAGVFWKQYRAVCLGLLPRQLAPAAFAAAARATASHRSPLEFAPFFPI
                                                                         

A0A8C6GZK8_BMF-02      ------------------------------------MEPPQCVEELEDDV
A0A8C6GZK8_BMF-03      ------------------------------------MEPPQCVEELEDDV
A0A8C6GZK8_BMF-01      ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDV
                                                           **************

A0A8C6GZK8_BMF-02      FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
A0A8C6GZK8_BMF-03      FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
A0A8C6GZK8_BMF-01      FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
                       **************************************************

A0A8C6GZK8_BMF-02      QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGS
A0A8C6GZK8_BMF-03      QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGS
A0A8C6GZK8_BMF-01      QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGS
                       **************************************************

A0A8C6GZK8_BMF-02      PLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQV
A0A8C6GZK8_BMF-03      PLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQV
A0A8C6GZK8_BMF-01      PLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQV
                       **************************************************

A0A8C6GZK8_BMF-02      FLFLQNLALNRQENREGVGPW
A0A8C6GZK8_BMF-03      FLFLQNLALNRQENREGVGPW
A0A8C6GZK8_BMF-01      FLFLQNLALNRQENREGVGPW
                       *********************

© 1998-2022Legal notice