Dataset for protein Bim of organism Moschus moschiferus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6DRY6_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
A0A8C6DRY6_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEEGDRC
A0A8C6DRY6_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEEGDRC
                        *****************************************         

A0A8C6DRY6_BCL2L11      ----------------------------------------------DRSP
A0A8C6DRY6_BCL2L11      PQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSP
A0A8C6DRY6_BCL2L11      PQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSP
                                                                      ****

A0A8C6DRY6_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELR
A0A8C6DRY6_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELR
A0A8C6DRY6_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELR
                        **************************************************

A0A8C6DRY6_BCL2L11      RIGDEFNAYYPRRVFVHHQAAAGHPQMVLLRVLRYLVRLVWRMQ
A0A8C6DRY6_BCL2L11      RIGDEFNAYYPRRVFVHHQAAAGHPQMVLLRVLRYLVRLVWRMQ
A0A8C6DRY6_BCL2L11      RIGDEFNAYYPRRL---------EPQ------------------
                        *************:          **                  

© 1998-2022Legal notice