Dataset for protein Puma of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GL32_BBC3-02      ------------------------------------------------------------
F7GL32_BBC3-01      MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRVVFQGLGVGLRSGECAPRLGVRVP
                                                                                

F7GL32_BBC3-02      ------------------------------------------------------MARAQQ
F7GL32_BBC3-01      CRERGPLSPRCCCRCECGAGLGKLRRGRARGVAPPLTCSAHLSVSLRRLPPHWGMARAQQ
                                                                          ******

F7GL32_BBC3-02      DGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPSSLLP
F7GL32_BBC3-01      DGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPSSLLP
                    ************************************************************

F7GL32_BBC3-02      LAYFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQGASPMS
F7GL32_BBC3-01      LAYFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQGASPMS
                    ************************************************************

F7GL32_BBC3-02      GGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLNALYEQRRREEEQRRHLSPWRLLYNLI
F7GL32_BBC3-01      GGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLNALYEQRRREEEQRRHLSPWRLLYNLI
                    ************************************************************

F7GL32_BBC3-02      SGLLAPQRRNRMPDVEPN
F7GL32_BBC3-01      SGLLAPQRRNRMPDVEPN
                    ******************

© 1998-2020Legal notice