Dataset for protein classical BH3-containing proteins of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3RXS8_BAD-01       MAAKFSISESESDSSEEVEGGKQKKSSARQEQQVSQRHALALPELRTTAS
A0A3Q3SYA1_BCL2L11      MATEESGDPPAGDPRVSAQTSRSNGGTDQSSVSPSRGRTRSIAHLDSLSV
                        **:: * . . .*.  ..: ...: .: ... . *. .: ::. * : : 

A0A3Q3RXS8_BAD-01       NRIR----LSSESQSRVDEEAGTPTDGAPFRGRSKSAPPALWAAKKYGQQ
A0A3Q3SYA1_BCL2L11      FHTRSIFQLPRRSSSGYFSSDGDSLPSSPLSPRPVTADKATQTPSLTSQV
                         . *    *.  *.*   .. * .  .:*:  *. :*  * .:..  .* 

A0A3Q3RXS8_BAD-01       LRRMSDEFDSLLDKGEMRVRNAGKAQKMHHSKTWWSYLFSYQETDGENNL
A0A3Q3SYA1_BCL2L11      MNHALQRLAEAHGGGAGAHRQHGEHKHLR------------------SRL
                        :..  : : .  . *    *: *: :::.                  ..*

A0A3Q3RXS8_BAD-01       HENHTPRTE----
A0A3Q3SYA1_BCL2L11      FTAHAEYTQVKQP
                        .  *:  *:    

© 1998-2021Legal notice