Dataset for protein Noxa of organism Marmota marmota marmota

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5YUG6_PMAIP1-      MPGKKGWKNE-QLTPVTPAVELESGIQLRRFGDKVNFRQKLLNLISKLFS
A0A8C6A7B1_PMAIP1-      MPGKKVSKHALNPTQVSAEVETEGMSQLRRFGDKLNFHKKLLNLIFRPFS
                        *****  *:  : * *:. ** *.  ********:**.:****** . **

A0A8C5YUG6_PMAIP1-      LVT
A0A8C6A7B1_PMAIP1-      ---
                           

© 1998-2022Legal notice