Dataset for protein Bad of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5XJR2_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5XJR2_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
                       **************************************************

A0A2K5XJR2_BAD-01      QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
A0A2K5XJR2_BAD-02      QQEQPTSSSHHGGTSSPEERGHSDADAAKLQLDASL--------------
                       *************:.: * *.. .: .*  : * .:              

A0A2K5XJR2_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVF
A0A2K5XJR2_BAD-02      -PVLVGSELGQGKLRPLPVTFA------PRPETPPALTVLVGHLGYGR--
                        * * .::    :** :.  *.      ***::. : * :    .: *  

A0A2K5XJR2_BAD-01      QSWWDRNLGRGSSAPSQ------------
A0A2K5XJR2_BAD-02      KCFPQASCKRGSVLPLSVGGLTQIPFRCM
                       :.: : .  ***  * .            

© 1998-2020Legal notice