Dataset for protein Bmf of organism Macaca nemestrina

[Download (right click)] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A2K6B5F6_BMF-01      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6B5F6_BMF-03      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6B5F6_BMF-02      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6B5F6_BMF-04      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A2K6B5F6_BMF-01      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6B5F6_BMF-03      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA
A0A2K6B5F6_BMF-02      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6B5F6_BMF-04      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
                       ***********************************************. *

A0A2K6B5F6_BMF-01      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6B5F6_BMF-03      EPKSRVVADP----PLPAQ-PCFEWRREQE--------------------
A0A2K6B5F6_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6B5F6_BMF-04      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
                         :  : *.     *:  * *  :*::. *                    

A0A2K6B5F6_BMF-01      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6B5F6_BMF-03      ------------------------------RGGP
A0A2K6B5F6_BMF-02      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6B5F6_BMF-04      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
                                                      *  

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice