Dataset for protein classical BH3-containing proteins of organism Latimeria chalumnae

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M3XHJ5_BCL2L11-01      --------------------------------MPTEESLQFDKDQGTSDV
H3ANP3_BAD-01          MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPN
H3ANP3_BAD-02          MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPN
H3ANP3_BAD-03          MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKHSRTAPN
                                                        *:*::  :.* . *:  

M3XHJ5_BCL2L11-01      ISECG--HLHPTQRP-----------DQPPFVKQEGCYCIISPLSKVIAL
H3ANP3_BAD-01          LQNPGPHQSHPPSHT-----------DNMEILGRPSSESQISDSESLDEL
H3ANP3_BAD-02          LQNPGPHQSHPPSHT-----------DNMEILGRPSSESQISDSESLDEL
H3ANP3_BAD-03          LQNPGPHQSHPPSHTGVYGWVKLRKRNNMEILGRPSSESQISDSESLDEL
                       :.: *  : **....           ::  :: . .. . **  ..:  *

M3XHJ5_BCL2L11-01      VRWRDRSLLSTLMGGLLLPPSPCPFVTRSPFFIFMRRSLVLSTSSSGYFT
H3ANP3_BAD-01          GPFRTRS-----------RSAPPNFWAARKYGQELRRMSD---------E
H3ANP3_BAD-02          GPFRTRS-----------RSAPPNFWAARKYGQELRRMSD---------E
H3ANP3_BAD-03          GPFRTRS-----------RSAPPNFWAARKYGQELRRMSD---------E
                         :* **            .:*  * :   :   :**             

M3XHJ5_BCL2L11-01      FDSDIVHSPAPVSVHKATQTPSPSSQLIVHVQHCLAQREQHPETHGKNPL
H3ANP3_BAD-01          FDMSFLGLPRPKSAGAAGEMVDES--WWKKLIRSLKGRGQPRDPPGQQGV
H3ANP3_BAD-02          FDMSFLGLPRPKSAGAAGEMVDES--WWKKLIRSLKGRGQPRDPPGQQGV
H3ANP3_BAD-03          FDMSFLGLPRPKSAGAAGEMVDES--WWKKLIRSLKGRGQPRDPPGQ---
                       ** .::  * * *.  * :  . *     :: ..*  * *  :. *:   

M3XHJ5_BCL2L11-01      NFT---
H3ANP3_BAD-01          SIRGPD
H3ANP3_BAD-02          SIRGPD
H3ANP3_BAD-03          ------
                             

© 1998-2020Legal notice