Dataset for protein classical BH3-containing proteins of organism Labrus bergylta

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3GUU5_BMF-01       -------------------------------------------MDDEEDD
A0A3Q3FKT9_BAD-01       -------------------------------------------------M
A0A3Q3ESW6_BCL2L11      MHRPSRPPNR---------LDGSPTVTESHGTRGDPPQTSRSDNSGGR--
A0A3Q3FKT9_BAD-03       ----MKCNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENKIS
                                                                          

A0A3Q3GUU5_BMF-01       VFEPDPHSWRTYFQEIKCE-------------DRGTQTPGPALAPNNGM-
A0A3Q3FKT9_BAD-01       TLTASDVTMAAKFTISDSESGSEEEVKEEEN-DQSSAVEEPHVPQRHSL-
A0A3Q3ESW6_BCL2L11      -----------NFGRTDSTGGGEPDSPSRCRFKPVSPVDSLGVFQKRSIF
A0A3Q3FKT9_BAD-03       CLGVLDVTMAAKFTISDSESGSEEEVKEEEN-DQSSAVEEPHVPQRHSL-
                                    *   ..              .  : .    :  ...: 

A0A3Q3GUU5_BMF-01       -LPCGVAEEPRPLFYGNAGFRLHFPANFELVGDQEESGQESE--------
A0A3Q3FKT9_BAD-01       TLPELRLAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPT--------
A0A3Q3ESW6_BCL2L11      HLP--RRASSGYFSYDGDSLPSSPLSPRPLTADKATQTPSPSGQVMQHAL
A0A3Q3FKT9_BAD-03       TLPELRLAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPT--------
                         **      .  :  .. .          * .    .   .         

A0A3Q3GUU5_BMF-01       --------------------LQQIGMEQQQPVAHSVEASIGLKLQLIGDQ
A0A3Q3FKT9_BAD-01       ------------------EGAPFRGRSKSAPPALWAAKKYGRQLRRMSDE
A0A3Q3ESW6_BCL2L11      QRMTEAHGGGPGTQQQYGHSPSLTSRRQRTAAGDMQAEAIGRDLQRIGDD
A0A3Q3FKT9_BAD-03       ------------------EGAPFRGRSKSAPPALWAAKKYGRQLRRMSDE
                                                .  :  . .       * .*. :.*:

A0A3Q3GUU5_BMF-01       F-----------------------------HREHLQLYHRNQRNQGPL--
A0A3Q3FKT9_BAD-01       FDILLDKGVRIKGGGGGSRGGCGLVVESVVSQPKSQEFNTQLLQPHVRCV
A0A3Q3ESW6_BCL2L11      YNRLLLWRMAGRHGRPEVHPN---------PQPHIQPEPTMLLCTGLMIL
A0A3Q3FKT9_BAD-03       FDILL------DKGEMKKVRS---------PGPAKQMHHSK---------
                        :                                  *              

A0A3Q3GUU5_BMF-01       ---WWRLGAALLSLLFDRGFIAGAGRR--
A0A3Q3FKT9_BAD-01       LGSLNVYKWDYLILI-------ITLHSSL
A0A3Q3ESW6_BCL2L11      LIGWIIYL---------RGNTNSHDHSQV
A0A3Q3FKT9_BAD-03       --SWWSYLFSHQETEGENNHHENHTHRNE
                                                 .   

© 1998-2020Legal notice