Dataset for protein classical BH3-containing proteins of organism Junco hyemalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5IIR3_BMF-01       -MDRPSYLEEDYSSLDGLDDDVFHSDDFG------------------LAG
A0A8C5IIR3_BMF-02       -MDRPSYLEEDYSSLDGLDDDVFHSDDFG------------------LAG
A0A8C5IZK3_BCL2L11      MAKQPPEVK---ARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSA
                          ..*. ::   :  ** .. :  ::. *                  ::.

A0A8C5IIR3_BMF-01       QPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC-----GPGIRHPEQQDK
A0A8C5IIR3_BMF-02       QPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC-----GPGIRHPEQQDK
A0A8C5IZK3_BCL2L11      ARGPPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFEAERSPAPLSCDK
                          *  ::.* *: ...   :: *  *:* : .      .     * . **

A0A8C5IIR3_BMF-01       ATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPQLQ
A0A8C5IIR3_BMF-02       ATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPQLQ
A0A8C5IZK3_BCL2L11      ATQTPSPPCQALSHCLSAMASR-----------WQSHSP-----------
                        **** **...: .  *.. .:            :. * *           

A0A8C5IIR3_BMF-01       EDPQEGQREARAEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFL
A0A8C5IIR3_BMF-02       EDPQEGQREARAEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFL
A0A8C5IZK3_BCL2L11      ------GEEVQPEIWIAQELRRIGDEFNASYCPRR---------------
                                *...*:.**.:*. *.*:*:  :  *.               

A0A8C5IIR3_BMF-01       HNLALNTEVNRNHTGQR
A0A8C5IIR3_BMF-02       HNLALNTEVNRNHTGQR
A0A8C5IZK3_BCL2L11      --VTFPSSPPVSLEGEG
                          ::: :.   .  *: 

© 1998-2022Legal notice