Dataset for protein Bmf of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287CXH0_BMF-01      MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVFIT
A0A287CXH0_BMF-02      --------------------------------------------------
                                                                         

A0A287CXH0_BMF-01      LDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQP
A0A287CXH0_BMF-02      -------------------VFPEEMEPPQCVEELEDDVFQPEDGEPGTQP
                                           .* ***************************

A0A287CXH0_BMF-01      GSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPA
A0A287CXH0_BMF-02      GSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPA
                       **************************************************

A0A287CXH0_BMF-01      SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQ
A0A287CXH0_BMF-02      SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQ
                       **************************************************

A0A287CXH0_BMF-01      HRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQILLFLHNLALNGDE
A0A287CXH0_BMF-02      HRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQILLFLHNLALNGDE
                       **************************************************

A0A287CXH0_BMF-01      NRDRAGPR
A0A287CXH0_BMF-02      NRDRAGPR
                       ********

© 1998-2020Legal notice