Dataset for protein Bad of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287CT05_BAD-02      MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQI
A0A287CT05_BAD-01      MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQI
                       **************************************************

A0A287CT05_BAD-02      PEFEPSEQEDSSSAEGGLGPSPAGDRPGCGLAPGLPRDTGHQQWQATSSS
A0A287CT05_BAD-01      PEFEPSEQEDSSSAEGGLGPSPAGDRPGCGLAPGLPRDTGHQQWQATSSS
                       **************************************************

A0A287CT05_BAD-02      NHGGAGATETRSRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQR
A0A287CT05_BAD-01      NHGGAGATETRSRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQR
                       **************************************************

A0A287CT05_BAD-02      YGRELRRMSDEFEGSFK--------------------VTFSQSPFLRA--
A0A287CT05_BAD-01      YGRELRRMSDEFEGSFKGLPRPRSAGTASQMRQSSSWTRFIQSWWDRNLG
                       *****************                    . * ** : *   

A0A287CT05_BAD-02      --------
A0A287CT05_BAD-01      RRGSAPSQ
                               

© 1998-2020Legal notice