Dataset for protein Puma of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9BXH1_BBC3-04      MKFGMGSAQACPCQVPRAASTTWVPCQIC-------------------------------
Q9BXH1_BBC3-05      MKFGMGSAQACPCQVPRAASTTWVPCQIC-------------------------------
Q9BXH1_BBC3-03      MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
B4DQK3_BBC3-01      MAPGSAMA-----------------------RARQEGSSPEPVEGLARDGP---RPFPLG
Q9BXH1_BBC3-06      ------MA-----------------------RARQEGSSPEPVEGLARDGP---RPFPLG
                           *                                                    

Q9BXH1_BBC3-04      ------------------------------------------------------------
Q9BXH1_BBC3-05      ------------------------------------------------------------
Q9BXH1_BBC3-03      ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP
B4DQK3_BBC3-01      RLVPSAVSCGL-------------------CEPGLAAAPAAPTLLPAAY-------LCAP
Q9BXH1_BBC3-06      RLVPSAVSCGL-------------------CEPGLAAAPAAPTLLPAAY-------LCAP
                                                                                

Q9BXH1_BBC3-04      ------------------------------------------------------------
Q9BXH1_BBC3-05      -----------------------------------------------------------G
Q9BXH1_BBC3-03      RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGS-PRGGGTVGPGDRGPAAADG
B4DQK3_BBC3-01      TAPPAVTAAL-------------------GGSRWPGGPRSRPRG-----------PRPDG
Q9BXH1_BBC3-06      TAPPAVTAAL-------------------GGSRWPGGPRSRPRG-----------PRPDG
                                                                                

Q9BXH1_BBC3-04      ----------ETRGAAAAPPLTLE-GPVQSHHGTPALTQGPQSPRD-GAQLGACTRPVDV
Q9BXH1_BBC3-05      PQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRG--EEEQWAREIGAQLRRMADDLNA
Q9BXH1_BBC3-03      GRPQRTVRAAETRGAAAAPPLTLE-GPVQSHHGTPALTQGPQSPRD-GAQLGACTRPVDV
B4DQK3_BBC3-01      PQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRG--EEEQWAREIGAQLRRMADDLNA
Q9BXH1_BBC3-06      PQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRG--EEEQWAREIGAQLRRMADDLNA
                                 ....:.* :*  **.*:  *. .  :  * .*: ****   :  ::.

Q9BXH1_BBC3-04      RDSGGRPLPPPDTLASAGDFLCTM-------------------
Q9BXH1_BBC3-05      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-03      RDSGGRPLPPPDTLASAGDFLCTM-------------------
B4DQK3_BBC3-01      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-06      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                    . .  *        .*.  .* .:                   

© 1998-2022Legal notice