Dataset for protein Puma of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9BXH1_BBC3-04      MKFGMGSAQACPCQVPRAASTTWVPCQIC-------------------------------
B4DQK3_BBC3-01      -------------------------------------MAPGSAMARARQEGSSPEPVEGL
Q9BXH1_BBC3-03      MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
                                                                                

Q9BXH1_BBC3-04      ------------------------------------------------------------
B4DQK3_BBC3-01      ARD------------------GPRPFPLGRLVP---------------SAVSCGLCEPGL
Q9BXH1_BBC3-03      ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP
                                                                                

Q9BXH1_BBC3-04      ------------------------------------------------------------
B4DQK3_BBC3-01      AAAPAAPTLLPAAYLCAP-TAPPAVTAALGGSRWPGGPRSRPRG-----------PRPDG
Q9BXH1_BBC3-03      RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGS-PRGGGTVGPGDRGPAAADG
                                                                                

Q9BXH1_BBC3-04      ----------ETRGAAAAPPLTLE-GPVQSHHGTPALTQGPQSPRD-GAQLGACTRPVDV
B4DQK3_BBC3-01      PQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRG--EEEQWAREIGAQLRRMADDLNA
Q9BXH1_BBC3-03      GRPQRTVRAAETRGAAAAPPLTLE-GPVQSHHGTPALTQGPQSPRD-GAQLGACTRPVDV
                                 ....:.* :*  **.*:  *. .  :  * .*: ****   :  ::.

Q9BXH1_BBC3-04      RDSGGRPLPPPDTLASAGDFLCTM-------------------
B4DQK3_BBC3-01      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-03      RDSGGRPLPPPDTLASAGDFLCTM-------------------
                    . .  *        .*.  .* .:                   

© 1998-2020Legal notice