Dataset for protein Bad of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q92934_BAD-06      ------------------------------------------------------------
Q92934_BAD-05      ------------------------------------------------------------
Q92934_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-04      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
B4DZQ9_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
                                                                               

Q92934_BAD-06      -------------------------MGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSD
Q92934_BAD-05      -------------------------MGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSD
Q92934_BAD-03      HGE---------------GTSSPEERGHSNADAAKLQLDASLPVLVGSELGQGKLRPLPV
Q92934_BAD-04      HGG---------RTSYSPSWESED--SENPSAGMLAEASAGMSAPAADSEAQ-HAENVKL
B4DZQ9_BAD-01      HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSD
Q92934_BAD-01      HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSD
Q92934_BAD-02      HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSD
                                             . . :     . .*     ...  ..     :  

Q92934_BAD-06      EFVDSFKKGL---PRPKSAG----------------------------------------
Q92934_BAD-05      EFVDSFKKGL---PRPKSAGTATQMRQSSSWTR---------------------------
Q92934_BAD-03      TFA----------PHPETPPVPTALGSHLEYGR---KYFPQAYAKRGSVLSPLEGGLTQI
Q92934_BAD-04      EALGLWRSGVATAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG-----
B4DZQ9_BAD-01      EFVDSFKKGL---PRPKSAGTATQMRQSPRRLR---------------------------
Q92934_BAD-01      EFVDSFKKGL---PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------
Q92934_BAD-02      EFVDSFKKGL---PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------
                                * *                                            

Q92934_BAD-06      -----
Q92934_BAD-05      -----
Q92934_BAD-03      PFRCV
Q92934_BAD-04      -----
B4DZQ9_BAD-01      -----
Q92934_BAD-01      -----
Q92934_BAD-02      -----
                        

© 1998-2022Legal notice