Dataset for protein Bad of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B4DZQ9_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
A8MXU7_BAD-04      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
A8MXU7_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
                   ************************************************************

B4DZQ9_BAD-01      HGGAGAVEIRSRHSSYPAGT-------------EDDEGMGEEPSPFRGR-----------
A8MXU7_BAD-04      HGGRTSYSPSWESEDSENPSAGMLA--------EASAGMSAPAADSEAQHAENVKLEALG
A8MXU7_BAD-03      HGEGTSSPEERGHSNADAAKLQLDASLPVLVGSELGQGKLRPLPVTFAPHPE--------
                   **   :       ..    .             * . *     .   .            

B4DZQ9_BAD-01      -------SRSAPPNLWAAQRYGRELRRMSDEFVDSF-KKGLPRPKSAGTATQMRQSPRRL
A8MXU7_BAD-04      LWRSGVATAPTPRGRRTTKGWGRS--------PAPFGAARARRPPTSGQHSAMAASSGG-
A8MXU7_BAD-03      -------TPPVPTALGSHLEYGRKY------FPQAYAKRGSVLSPLEGGLTQIPFRCV--
                          : ..*    :   :**.          .:       .   *  : :       

B4DZQ9_BAD-01      R
A8MXU7_BAD-04      -
A8MXU7_BAD-03      -
                    

© 1998-2020Legal notice