Dataset for protein Bad of organism Homo sapiens

[Download (right click)] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


Q92934_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-04      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
B4DZQ9_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
Q92934_BAD-06      ------------------------------------------------------------
Q92934_BAD-05      ------------------------------------------------------------
Q92934_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
                                                                               

Q92934_BAD-02      HGGAGA--VE--IRSRHS------------------------------------------
Q92934_BAD-04      HGGRTSYSPSWESEDSENPSAG-MLAEA----------SAGMSAPAADSEAQHAENVKLE
Q92934_BAD-03      HGEGTS-SPE--ERGHSNADAAKLQLDASLPVLVGSELGQGKLRPLPVTFAPHPE-----
B4DZQ9_BAD-01      HGGAGA--VE--IRSRHS------------------------------------------
Q92934_BAD-06      ------------------------------------------------------------
Q92934_BAD-05      ------------------------------------------------------------
Q92934_BAD-01      HGGAGA--VE--IRSRHS------------------------------------------
                                                                               

Q92934_BAD-02      ------------SYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFV
Q92934_BAD-04      ALGLWRSGVATAPTPRGRRTTKGWGRSPAPFGA-AR------------------------
Q92934_BAD-03      ----------TPPVPTALGSHLEYGRKYFPQAY-AK------------------------
B4DZQ9_BAD-01      ------------SYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFV
Q92934_BAD-06      -----------------------MGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFV
Q92934_BAD-05      -----------------------MGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFV
Q92934_BAD-01      ------------SYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFV
                                           *..  *    ::                        

Q92934_BAD-02      DSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Q92934_BAD-04      ------ARRPPTSGQHSAMAASS---------------------GG
Q92934_BAD-03      ----RGSVLSPLEGGLTQIP-FR---------------------CV
B4DZQ9_BAD-01      DSFKKGLPRPKSAGTATQMRQSPRRLR-------------------
Q92934_BAD-06      DSFKKGLPRPKSAG--------------------------------
Q92934_BAD-05      DSFKKGLPRPKSAGTATQMRQSSSWTR-------------------
Q92934_BAD-01      DSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
                            .   *                                

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice