Dataset for protein Bim of organism Heterocephalus glaber

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G5BQZ0_BCL2L11-02      MAKQPSDVSCECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPEV
G5BQZ0_BCL2L11-01      MAKQPSDVSCECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPEV
G5BQZ0_BCL2L11-04      MAKQPSDVSCECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
G5BQZ0_BCL2L11-03      MAKQPSDVSCECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
                       *****************************************         

G5BQZ0_BCL2L11-02      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
G5BQZ0_BCL2L11-01      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
G5BQZ0_BCL2L11-04      --------------------------------------------------
G5BQZ0_BCL2L11-03      --------------------------------------------------
                                                                         

G5BQZ0_BCL2L11-02      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPPDMRPEIWI
G5BQZ0_BCL2L11-01      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPPDMRPEIWI
G5BQZ0_BCL2L11-04      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMG------------------
G5BQZ0_BCL2L11-03      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPPDMRPEIWI
                        ******************************.                  

G5BQZ0_BCL2L11-02      AQELRRIGDEFNASYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLVWRMH
G5BQZ0_BCL2L11-01      AQELRRIGDEFNASYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLVWRMH
G5BQZ0_BCL2L11-04      --------------YPESLHSC----------------------------
G5BQZ0_BCL2L11-03      AQELRRIGDEFNASYPRRVFLNNYQPAEDHPQMVILRLLRYIVRLVWRMH
                                     **  :.                              

© 1998-2020Legal notice