Dataset for protein Bad of organism Heterocephalus glaber

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G5B6Q3_BAD-01      MRTPENPSPAPTNAEGLRKLELGIRRLESAQSMFQIPEFEPSEQEDSSSEERALGPTPTG
G5B6Q3_BAD-02      --------------------------------MFQIPEFEPSEQEDSSSEERALGPTPTG
                                                   ****************************

G5B6Q3_BAD-01      DRLGPSSPGGFLGDISHQQRQLISSRHHGGTGATETRSRHSSYPTGMEEEAGMKEEPSPF
G5B6Q3_BAD-02      DRLGPSSPGGFLGDISHQQRQLISSRHHGGTGATETRSRHSSYPTGMEEEAGMKEEPSPF
                   ************************************************************

G5B6Q3_BAD-01      RGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQSSSWTRAIQSW
G5B6Q3_BAD-02      RGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQSSSWTRAIQSW
                   ************************************************************

G5B6Q3_BAD-01      WDRNLGRGGSAPSQ
G5B6Q3_BAD-02      WDRNLGRGGSAPSQ
                   **************

© 1998-2020Legal notice