Dataset for protein Noxa of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YVQ5_PMAIP1-      MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIEMQLRFTRGKKLLSSSP
A0A2I2YVQ5_PMAIP1-      MPGKKARKNAQPSPARAPA-------------------------------
                        *******************                               

A0A2I2YVQ5_PMAIP1-      LALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTA
A0A2I2YVQ5_PMAIP1-      -------ELEVECATQLRRFGDKLNFRQKLL-------------------
                               * :*: * .   :. :  :**. *                   

A0A2I2YVQ5_PMAIP1-      SKTCMRGLLQKSFLRRCTFHQFEERLHCNWEECEGAFMGALGNGRWNTSK
A0A2I2YVQ5_PMAIP1-      ------NLISKLF-------------------CSGT--------------
                              .*:.* *                   *.*:              

© 1998-2022Legal notice