Dataset for protein Bad of organism Gorilla gorilla gorilla

[Download (right click)] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A2I2YFH2_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2YFH2_BAD-04      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2YFH2_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2YFH2_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
                       **************************************************

A0A2I2YFH2_BAD-02      QQEQPTSSSHHGGAGA-VEI-RSRHSSYPA-------------GTEDDEG
A0A2I2YFH2_BAD-04      QQEQPTSSSHHGGRTSYSPSWESEDSENPSAGMLAEAS----------AG
A0A2I2YFH2_BAD-03      QQEQPTSSSHHGEGTS-SPE-ERRHSNADAAKLQLDASLPVLVGSELGQG
A0A2I2YFH2_BAD-01      QQEQPTSSSHHGGAGA-VEI-RSRHSSYPA-------------GTEDDEG
                       ************   :     . ..*.  :                   *

A0A2I2YFH2_BAD-02      M-GEEPSPFRGRSR---------------S--APPNLWAAQRYGRELRRM
A0A2I2YFH2_BAD-04      MSAPAADSEAQHAENVKLEALGLWRSGVATAPTPRGRRTTKGWGRSP---
A0A2I2YFH2_BAD-03      KLRPLPVTFAAHPE---------------TPPVPTALGSHLEYGRKY---
A0A2I2YFH2_BAD-01      M-GEEPSPFRGRSR---------------S--APPNLWAAQRYGRELRRM
                            . .   :..               :  .*    :   :**.    

A0A2I2YFH2_BAD-02      SDEFVDSF-KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAP
A0A2I2YFH2_BAD-04      ---AP--FGAARARRPPTSGQHSAMAASS---------------------
A0A2I2YFH2_BAD-03      ---FPQAYAKRGSVLSPLEGRLTQIPF-R---------------------
A0A2I2YFH2_BAD-01      SDEFVDSF-KKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAP
                              :       .   *  : :                         

A0A2I2YFH2_BAD-02      SQ
A0A2I2YFH2_BAD-04      GG
A0A2I2YFH2_BAD-03      CV
A0A2I2YFH2_BAD-01      SQ
                         

© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice