Dataset for protein Bad of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2Z8C7_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2Z8C7_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
A0A2I2Z8C7_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH
                       **************************************************

A0A2I2Z8C7_BAD-03      QQEQPTSSSHHGEGTSSPEERRHSNADAA--------------KLQLDAS
A0A2I2Z8C7_BAD-02      QQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
A0A2I2Z8C7_BAD-01      QQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA
                       ************ . :     ***.  *.              . .  ::

A0A2I2Z8C7_BAD-03      LPVLVGSELGQGKLRPLPVTFA-------AHPETPPVPTALGSHLEYGRK
A0A2I2Z8C7_BAD-02      PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV
A0A2I2Z8C7_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV
                        * * .::    :** :.  *.       ..*::. ..* : .  .: * 

A0A2I2Z8C7_BAD-03      YFPQAYAKRGSVLSPLEGRLTQIPFRCV
A0A2I2Z8C7_BAD-02      F--QSWWDRNL------GRGSSAPSQ--
A0A2I2Z8C7_BAD-01      F--QSWWDRNL------GRGSSAPSQ--
                       :  *:: .*.       ** :. * .  

© 1998-2020Legal notice