Dataset for protein Bmf of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A9XRH0_BMF-01          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A0A3Q2UCA0_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A3Q2UCA0_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A3Q2UCA0_BMF-03      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A3Q2UCA0_BMF-04      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                       ******************************                    

A9XRH0_BMF-01          --------------------------------------------------
A0A3Q2UCA0_BMF-02      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A3Q2UCA0_BMF-01      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A3Q2UCA0_BMF-03      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A3Q2UCA0_BMF-04      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                                                                         

A9XRH0_BMF-01          -----GNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A3Q2UCA0_BMF-02      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A3Q2UCA0_BMF-01      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A3Q2UCA0_BMF-03      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A3Q2UCA0_BMF-04      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
                            *********************************************

A9XRH0_BMF-01          DQFHRLHIQRHQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-
A0A3Q2UCA0_BMF-02      DQFHRLHIQRVGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ
A0A3Q2UCA0_BMF-01      DQFHRLHIQRVGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ
A0A3Q2UCA0_BMF-03      DQFHRLHIQRHQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-
A0A3Q2UCA0_BMF-04      DQFHRLHIQRHQQNRNQVWWQLFLFL------HNLALNVEANRNRTGQR-
                       **********    ..  *   :* :       .* *.    .  :* * 

© 1998-2020Legal notice