Dataset for protein Bim of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A2I2UX96_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
                        *****************************************         

A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      -----------------------------------------------DRS
A0A2I2UX96_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRS
A0A2I2UX96_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                          

A0A2I2UX96_BCL2L11      ---------------------------ASMRQPQAVPADMRPEIWIAQEL
A0A2I2UX96_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A2I2UX96_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A2I2UX96_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
                                                   ***********************

A0A2I2UX96_BCL2L11      RRIGDEFNAYYPRRLARVPASYI-----------------------
A0A2I2UX96_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
A0A2I2UX96_BCL2L11      RRIGDEFNAYYPRRLEQ-----------------------------
A0A2I2UX96_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
                        **************:                               

© 1998-2022Legal notice