Dataset for protein Bim of organism Felis catus

[Download (right click)] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A2I2UX96_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A2I2UX96_BCL2L11-04      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A2I2UX96_BCL2L11-03      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A2I2UX96_BCL2L11-02      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
                           *****************************************         

A0A2I2UX96_BCL2L11-01      CPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRS
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      CPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTDRS
A0A2I2UX96_BCL2L11-02      -----------------------------------------------DRS
                                                                             

A0A2I2UX96_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A2I2UX96_BCL2L11-04      ---------------------------ASMRQPQAVPADMRPEIWIAQEL
A0A2I2UX96_BCL2L11-03      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A2I2UX96_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
                                                      ***********************

A0A2I2UX96_BCL2L11-01      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
A0A2I2UX96_BCL2L11-04      RRIGDEFNAYYPRRL-----------------------ARVPASYI
A0A2I2UX96_BCL2L11-03      RRIGDEFNAYYPRRL-----------------------------EQ
A0A2I2UX96_BCL2L11-02      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
                           **************:                               

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice