Dataset for protein Bmf of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2HR24_BMF-02      MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLF
A0A3Q2HR24_BMF-01      MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLF
                       **************************************************

A0A3Q2HR24_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A3Q2HR24_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
                       **************************************************

A0A3Q2HR24_BMF-02      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQ
A0A3Q2HR24_BMF-01      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQ
                       **************************************************

A0A3Q2HR24_BMF-02      QHQQNRNRVWWQTLLFLHNLALNGDENRNGAGPRCGKNVRGPVRELETSD
A0A3Q2HR24_BMF-01      QHQQNRNRVWWQTLLFLHNLALNGDENRNGAGPSFQPGQEGVLWKSAGLQ
                       *********************************    .  * :.:    :

A0A3Q2HR24_BMF-02      LFLSCHPELPPAPGFCQDFVLS--WS-
A0A3Q2HR24_BMF-01      LPLSELLPFSPCCGTNGENLKQPVWLL
                       * **    :.*. *   : : .  *  

© 1998-2020Legal notice