Dataset for protein classical BH3-containing proteins of organism Cyanoderma ruficeps

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3NS85_BCL2L11      MAKQPPEVK---ARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGPVSA
A0A8C3QVS1_BMF-01       -MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQ-----------------
                          ..*. ::   :  ** .. :  ::. * ..*                 

A0A8C3NS85_BCL2L11      AAAARGPPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFDAERSPAPLG
A0A8C3QVS1_BMF-01       ----PGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC-----GPGIRHPEQ
                             *  ::.* *: ...   :: *  *:* : .      .     *  

A0A8C3NS85_BCL2L11      CDKATQTPSPPCQALSHCLSAMASR-----------WQSHSPAE------
A0A8C3QVS1_BMF-01       QDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDP
                         ****** **...: .  *.. .:            :. * *.       

A0A8C3NS85_BCL2L11      -----------EVQPEIWIAQELRRIGDEFNASYCPRRGFLDHQVGNPQV
A0A8C3QVS1_BMF-01       HLQEEPQEGQREARAEVQIARKLQCIADQFH------RLHIQRHQQNRNQ
                                   *...*:.**.:*. *.*:*:      * .::.:  * : 

A0A8C3NS85_BCL2L11      VILRLLRYIIRLIWRFQ---------
A0A8C3QVS1_BMF-01       VWWQLFLFLHNLALNTEVNRNHTGQR
                        *  .*: :: .*  . :         

© 1998-2022Legal notice