Dataset for protein classical BH3-containing proteins of organism Ctenopharyngodon idella

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0P0HZF9_PMAIP1-      --------------------------------------------------
A0A8F1NN26_BAD-01       MAQMFSISDNESETSEDREDP--DQTEHNSGLPQGKQLRTVPDSLKGEQL
A0A8F1NN29_BAD-01       MDNTLHDHQDDSSALDGKKTSHLEETIKNHGQHQDQTLPNISPQRRVRLY
                                                                          

A0A0P0HZF9_PMAIP1-      ---------------------------------------MAKKEKTAVVE
A0A8F1NN26_BAD-01       GRQRNLSMN-----------EDLLEAGAADEGDFRPRSRSAPPALWAAKK
A0A8F1NN29_BAD-01       SESQVYTVSRWQDAEPQDGASAEENGGAGDGLPFRGRSQSAPAALWKAKK
                                                                *      . :

A0A0P0HZF9_PMAIP1-      CAQQLRTIGDLFD-------------------------WKYKLLEIIIAL
A0A8F1NN26_BAD-01       YGRQLRRMSDEFDILLDKG-MKRVKSAGTARQMQQSPSW------LAFLW
A0A8F1NN29_BAD-01       YGRQLRRMSDEFDTWLDKGEVKRVK--------QTYRGW------FSFLW
                         ..*** :.* **                         *      : :  

A0A0P0HZF9_PMAIP1-      QKAQTDGKR----
A0A8F1NN26_BAD-01       SHKESDAESRPAE
A0A8F1NN29_BAD-01       SPKEEEGRE----
                        .  : :.      

© 1998-2022Legal notice