Dataset for protein Bmf of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2MZN7_BMF-01      MPGAGVFWKQYREVRRGLLPRQLAPAAATAPARATASCRSPLEFAPSFPI
A0A8C2MZN7_BMF-02      --------------------------------------------------
                                                                         

A0A8C2MZN7_BMF-01      ECGRQAPRVLITLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDV
A0A8C2MZN7_BMF-02      -------------------------------LFPGEMEPPQCVEELEDDV
                                                       .*****************

A0A8C2MZN7_BMF-01      FQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
A0A8C2MZN7_BMF-02      FQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
                       **************************************************

A0A8C2MZN7_BMF-01      QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGL
A0A8C2MZN7_BMF-02      QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGL
                       **************************************************

A0A8C2MZN7_BMF-01      PLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRDRAWWQVF
A0A8C2MZN7_BMF-02      PLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRDRAWWQVF
                       **************************************************

A0A8C2MZN7_BMF-01      LFLQNLALNREENREGVGPW
A0A8C2MZN7_BMF-02      LFLQNLALNREENREGVGPW
                       ********************

© 1998-2022Legal notice