Dataset for protein Bim of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3H020_BCL2L11-02      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
G3H020_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGDGDR
                       *****************************************         

G3H020_BCL2L11-02      -----------------------------------------------DRS
G3H020_BCL2L11-01      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                      ***

G3H020_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQEL
G3H020_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPADIRPEIWIAQEL
                       **************************************************

G3H020_BCL2L11-02      RRIGDEFNESYRRRANNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH
G3H020_BCL2L11-01      RRIGDEFNESYRRRANNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH
                       ***********************************************

© 1998-2020Legal notice