Dataset for protein Bmf of organism Chrysemys picta bellii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3P5Z9_BMF-01      MDPPSYLEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCL
A0A8C3P5Z9_BMF-02      MDPPSYLEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCL
                       **************************************************

A0A8C3P5Z9_BMF-01      LGRFQLFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQ
A0A8C3P5Z9_BMF-02      LGRFQLFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQ
                       **************************************************

A0A8C3P5Z9_BMF-01      RLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREARTEVQIARKLQCIAD
A0A8C3P5Z9_BMF-02      RLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREARTEVQIARKLQCIAD
                       **************************************************

A0A8C3P5Z9_BMF-01      QFHRLHIQRHQQNRNQVWWQILLFLHNLALNVEANRNHVGQR
A0A8C3P5Z9_BMF-02      QFHRLHIQRHQQNRNQVWWQILLFLHNLALNVEANRNHVGQR
                       ******************************************

© 1998-2022Legal notice